PDB entry 1jvk

View 1jvk on RCSB PDB site
Description: three-dimensional structure of an immunoglobulin light chain dimer acting as a lethal amyloid precursor
Class: immune system
Keywords: Immunoglobulin light chain dimer, amyloidogenic, IMMUNE SYSTEM
Deposited on 2001-08-30, released 2002-05-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.223
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin lambda light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1jvka1, d1jvka2
  • Chain 'B':
    Compound: immunoglobulin lambda light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1jvkb1, d1jvkb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jvkA (A:)
    etaltqpasvsgspgqsitvsctgvssivgsynlvswyqqhpgkapklltyevnkrpsgv
    sdrfsgsksgnsasltisglqaedeadyycssydgsstsvvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptac
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jvkB (B:)
    etaltqpasvsgspgqsitvsctgvssivgsynlvswyqqhpgkapklltyevnkrpsgv
    sdrfsgsksgnsasltisglqaedeadyycssydgsstsvvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jvkB (B:)
    etaltqpasvsgspgqsitvsctgvssivgsynlvswyqqhpgkapklltyevnkrpsgv
    sdrfsgsksgnsasltisglqaedeadyycssydgsstsvvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapta