PDB entry 1jvj

View 1jvj on RCSB PDB site
Description: crystal structure of n132a mutant of tem-1 beta-lactamase in complex with a n-formimidoyl-thienamycine
Class: hydrolase
Keywords: protein stability, TEM-1, beta-lactamase, beta-lactam, antibiotic resistance, imipenem, HYDROLASE
Deposited on 2001-08-30, released 2002-03-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.162
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beta-lactamase TEM
  Species: Escherichia coli [TaxId:562]
  Gene: bla
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62593 (0-262)
    • engineered (106)
  Domains in SCOPe 2.01: d1jvja_
• Heterogens: K, IM2, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jvjA (A:)
  hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
  agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdataanlllttiggp
  keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
  qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
  sqatmdernrqiaeigaslikhw