PDB entry 1jvf

View 1jvf on RCSB PDB site
Description: Crystal structure of Enoyl-Acyl Carrier protein Reductase from Helicobacter pylori
Class: oxidoreductase
Keywords: Triclosan
Deposited on 2001-08-29, released 2003-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2007-04-17, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.229
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-ACP reductase
    Species: Helicobacter pylori
    Gene: FabI
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Enoyl-ACP reductase
    Species: Helicobacter pylori
    Gene: FabI
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Enoyl-ACP reductase
    Species: Helicobacter pylori
    Gene: FabI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jvfc_
  • Chain 'D':
    Compound: Enoyl-ACP reductase
    Species: Helicobacter pylori
    Gene: FabI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jvfd_
  • Heterogens: NAD, TCL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jvfC (C:)
    mgflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyv
    yeldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisv
    yslieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhh
    irvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvs
    gevhfvdagyhvmgmgaveekdnkatllwdlhkeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jvfC (C:)
    gflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyvy
    eldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisvy
    slieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhhi
    rvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvsg
    evhfvdagyhvmgmgaveekdnkatllwdlhkeq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jvfD (D:)
    mgflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyv
    yeldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisv
    yslieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhh
    irvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvs
    gevhfvdagyhvmgmgaveekdnkatllwdlhkeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jvfD (D:)
    gflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyvy
    eldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisvy
    slieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhhi
    rvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvsg
    evhfvdagyhvmgmgaveekdnkatllwdlhkeq