PDB entry 1jvf

View 1jvf on RCSB PDB site
Description: Crystal structure of Enoyl-Acyl Carrier protein Reductase from Helicobacter pylori
Deposited on 2001-08-29, released 2003-12-23
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.229
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1jvfa_
  • Chain 'B':
    Domains in SCOP 1.69: d1jvfb_
  • Chain 'C':
    Domains in SCOP 1.69: d1jvfc_
  • Chain 'D':
    Domains in SCOP 1.69: d1jvfd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jvfA (A:)
    mgflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyv
    yeldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisv
    yslieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhh
    irvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvs
    gevhfvdagyhvmgmgaveekdnkatllwdlhkeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jvfA (A:)
    gflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyvy
    eldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisvy
    slieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhhi
    rvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvsg
    evhfvdagyhvmgmgaveekdnkatllwdlhkeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jvfB (B:)
    mgflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyv
    yeldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisv
    yslieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhh
    irvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvs
    gevhfvdagyhvmgmgaveekdnkatllwdlhkeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jvfB (B:)
    gflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyvy
    eldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisvy
    slieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhhi
    rvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvsg
    evhfvdagyhvmgmgaveekdnkatllwdlhkeq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jvfC (C:)
    mgflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyv
    yeldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisv
    yslieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhh
    irvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvs
    gevhfvdagyhvmgmgaveekdnkatllwdlhkeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jvfC (C:)
    gflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyvy
    eldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisvy
    slieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhhi
    rvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvsg
    evhfvdagyhvmgmgaveekdnkatllwdlhkeq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jvfD (D:)
    mgflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyv
    yeldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisv
    yslieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhh
    irvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvs
    gevhfvdagyhvmgmgaveekdnkatllwdlhkeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jvfD (D:)
    gflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyvy
    eldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisvy
    slieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhhi
    rvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvsg
    evhfvdagyhvmgmgaveekdnkatllwdlhkeq