PDB entry 1jva

View 1jva on RCSB PDB site
Description: crystal structure of the vma1-derived endonuclease bearing the n and c extein propeptides
Deposited on 2001-08-29, released 2002-08-29
The last revision prior to the SCOP 1.71 freeze date was dated 2002-08-29, with a file datestamp of 2002-08-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jvaA (A:)
    msnsdaiiyvgsfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmys
    vvqksqhrahksdssrevpellkftcnatnelvvrtprsvrrlsrtikgveyfevitfem
    gqkkapdgrivelvkevsksypisegperanelvesyrkasnkayfewtieardlsllgs
    hvrkatyqtyapilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvd
    srdtslmervteyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwda
    ivglgflkdgvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdg
    lvslarslglvvsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapa
    aafarecrgfyfelqelkeddyygitlsddsdhqfllanqvvvhssgergnemae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jvaA (A:)
    vgsfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksevpe
    llkftcnatnelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgrivelvkevsks
    ypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtyapilyendhf
    fdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervteyaeklnlc
    aeykdrkepqvaktvnlyskvenplwdaivglgflkdgvknipsflstdnigtretflag
    lidsdgyvtdehgikatiktihtsvrdglvslarslglvvsvnaepkisyaiymsggdvl
    lnvlskcagskkfrpapaaafarecrgfyfelqelkeddyygitlsddsdhqfllanqvv
    vhssger
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jvaB (B:)
    msnsdaiiyvgsfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmys
    vvqksqhrahksdssrevpellkftcnatnelvvrtprsvrrlsrtikgveyfevitfem
    gqkkapdgrivelvkevsksypisegperanelvesyrkasnkayfewtieardlsllgs
    hvrkatyqtyapilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvd
    srdtslmervteyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwda
    ivglgflkdgvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdg
    lvslarslglvvsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapa
    aafarecrgfyfelqelkeddyygitlsddsdhqfllanqvvvhssgergnemae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jvaB (B:)
    iiyvgsfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksp
    ellkftcnatnelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgrivelvkevsk
    sypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtyapilyendh
    ffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervteyaeklnl
    caeykdrkepqvaktvnlyslntenplwdaivglgflkdgvknipsflstdnigtretfl
    aglidsdgyvtdehgikatiktihtsvrdglvslarslglvvsvnaephkisyaiymsgg
    dvllnvlskcagskkfrpapaaafarecrgfyfelqelkeddyygitlsddsdhqfllan
    qvvvhssger