PDB entry 1jv9

View 1jv9 on RCSB PDB site
Description: NMR Structure of BPTI Mutant G37A
Class: blood clotting
Keywords: BPTI, G37A Mutant, Conformational Strain, Minimized Average Structure, BLOOD CLOTTING
Deposited on 2001-08-28, released 2001-09-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: trypsin inhibitor
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00974 (0-57)
    • engineered (36)
  Domains in SCOPe 2.08: d1jv9a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jv9A (A:)
  rpdfcleppytgpckariiryfynakaglcqtfvygacrakrnnfksaedcmrtcgga