PDB entry 1jv5

View 1jv5 on RCSB PDB site
Description: Anti-blood group A Fv
Class: Immune System, Sugar Binding Protein
Keywords: immunoglobulin, Immune System, Sugar Binding Protein
Deposited on 2001-08-28, released 2002-01-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.183
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig kappa chain precursor V region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1jv5a_
  • Chain 'B':
    Compound: Ig chain heavy chain precursor V region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB E29380 (0-116)
    Domains in SCOPe 2.03: d1jv5b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jv5A (A:)
    diqmtqttsslsaslgdrvtiscrasqdinnylnwyqqkpdgtvkllihytsrlhsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgntlpwtfgggtkleik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jv5B (B:)
    qvqlqqpgaelvkpgtsvklsckasgynftsywinwvklrpgqglewigdiypgsgitny
    nekfkskatltvdtssstaymqlsslasedsalyycagqygnlwfaywgqgtlvtvs