PDB entry 1jv5

View 1jv5 on RCSB PDB site
Description: anti-blood group a fv
Deposited on 2001-08-28, released 2002-01-09
The last revision prior to the SCOP 1.71 freeze date was dated 2002-01-30, with a file datestamp of 2002-01-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.183
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1jv5a_
  • Chain 'B':
    Domains in SCOP 1.71: d1jv5b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jv5A (A:)
    diqmtqttsslsaslgdrvtiscrasqdinnylnwyqqkpdgtvkllihytsrlhsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgntlpwtfgggtkleik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jv5B (B:)
    qvqlqqpgaelvkpgtsvklsckasgynftsywinwvklrpgqglewigdiypgsgitny
    nekfkskatltvdtssstaymqlsslasedsalyycagqygnlwfaywgqgtlvtvs