PDB entry 1jv2

View 1jv2 on RCSB PDB site
Description: crystal structure of the extracellular segment of integrin alphavbeta3
Class: cell adhesion
Keywords: genu, hybrid domain, beta-tail domain, PSI domain, EGF domain, MIDAS, ADMIDAS, Cage motif, propeller, A-domain, thigh domain, calf domain, CELL ADHESION
Deposited on 2001-08-28, released 2001-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.255
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrin, alpha v
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB XP_002379 (0-End)
    Domains in SCOPe 2.07: d1jv2a1, d1jv2a2, d1jv2a3, d1jv2a4
  • Chain 'B':
    Compound: platelet membrane glycoprotein iiia beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAB71380
    Domains in SCOPe 2.07: d1jv2b1, d1jv2b2, d1jv2b3, d1jv2b4, d1jv2b5
  • Heterogens: NAG, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jv2A (A:)
    fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
    wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
    erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
    gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
    sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
    mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
    aapyggedkkgivyifngrstglnavpsqilegqwaarsmppsfgysmkgatdidkngyp
    dlivgafgvdrailyrarpvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclk
    adgkgvlprklnfqvellldklkqkgairralflysrspshsknmtisrgglmqceelia
    ylrdesefrdkltpitifmeyrldyrtaadttglqpilnqftpanisrqahilldcgedn
    vckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvrnn
    ealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiqss
    nlfdkvspvvshkvdlavlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiy
    elrnngpssfskamlhlqwpykynnntllyilhydidgpmnctsdmeinplrikisslqt
    tekndtvagqgerdhlitkrdlalsegdihtlgcgvaqclkivcqvgrldrgksailyvk
    sllwtetfmnkenqnhsyslkssasfnviefpyknlpieditnstlvttnvtwgiqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jv2A (A:)
    fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
    wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
    erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
    gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
    sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
    mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
    aapyggedkkgivyifngrstglnavpsqilegqwaarsmppsfgysmkgatdidkngyp
    dlivgafgvdrailyrarpvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclk
    adgkgvlprklnfqvellldklkqkgairralflysrspshsknmtisrgglmqceelia
    ylrdesefrdkltpitifmeyrldyrtaadttglqpilnqftpanisrqahilldcgedn
    vckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvrnn
    ealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiqss
    nlfdkvspvvshkvdlavlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiy
    elrnngpssfskamlhlqwpykynnntllyilhydidgpmnctsdmeinplrikissldi
    htlgcgvaqclkivcqvgrldrgksailyvksllwtetfmnkenqnhsyslkssasfnvi
    efpyknlpieditnstlvttnvtwgiq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jv2B (B:)
    gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefpvse
    arvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqvedypvdiyylmdl
    sysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymyisppealenpcydm
    kttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdaimqatvcdekigwrn
    dashllvfttdakthialdgrlagivqpndgqchvgsdnhysasttmdypslglmtekls
    qkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivdaygkirskvelevr
    dlpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvg
    fkdslivqvtfdcdcacqaqaepnshrcnngngtfecgvcrcgpgwlgsqcecseedyrp
    sqqdecspregqpvcsqrgeclcgqcvchssdfgkitgkycecddfscvrykgemcsghg
    qcscgdclcdsdwtgyycncttrtdtcmssngllcsgrgkcecgscvciqpgsygdtcek
    cptcpdactfkkecveckkfdrepymtentcnrycrdeiesvkelkdtgkdavnctykne
    ddcvvrfqyyedssgksilyvveepecpkgpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jv2B (B:)
    efpvsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqvedypvdi
    yylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymyisppeale
    npcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdaimqatvcde
    kigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysasttmdypslgl
    mteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivdaygkirsk
    velevrdlpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksf
    tikpvgfkdslivqvtfdcdkgemcsghgqcscgdclcdsdwtgyycncttrtdtcmssn
    gllcsgrgkcecgscvciqpgsygdtcekcptcpdactfkkecveckkfdrepymtentc
    nrycrdeiesvkelkdtgkdavnctykneddcvvrfqyyedssgksilyvveepecpkg