PDB entry 1juv

View 1juv on RCSB PDB site
Description: Crystal structure analysis of Dihydrofolate reductase from Bacteriophage T4
Class: oxidoreductase
Keywords: complexed with NADPH, OXIDOREDUCTASE
Deposited on 2001-08-28, released 2003-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.227
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: frd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1juva_
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1juvA (A:)
    miklvfrysptktvdgfnelafglgdglpwgrvkkdlqnfkartegtimimgaktfqslp
    tllpgrshivvcdlardypvtkdgdlahfyitweqyityisggeiqvsspnapfetmldq
    nskvsviggpallyaalpyadevvvsrivkrhrvnstvqldasflddiskremvethwyk
    idevttltesvyk