PDB entry 1juq

View 1juq on RCSB PDB site
Description: GGA3 VHS domain complexed with C-terminal peptide from cation-dependent Mannose 6-phosphate receptor
Class: signaling protein
Keywords: protein-peptide compelx; VHS domain; dxxll sorting signal, SIGNALING PROTEIN
Deposited on 2001-08-26, released 2002-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.221
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor binding protein gga3
    Species: Homo sapiens [TaxId:9606]
    Gene: GGA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ52
      • modified residue (77)
      • modified residue (127)
      • modified residue (141)
    Domains in SCOPe 2.06: d1juqa_
  • Chain 'B':
    Compound: ADP-ribosylation factor binding protein gga3
    Species: Homo sapiens [TaxId:9606]
    Gene: GGA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ52 (5-End)
      • modified residue (5)
      • modified residue (77)
      • modified residue (127)
      • modified residue (141)
      • cloning artifact (3-4)
    Domains in SCOPe 2.06: d1juqb1, d1juqb2
  • Chain 'C':
    Compound: ADP-ribosylation factor binding protein gga3
    Species: Homo sapiens [TaxId:9606]
    Gene: GGA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ52
      • modified residue (77)
      • modified residue (127)
      • modified residue (141)
    Domains in SCOPe 2.06: d1juqc_
  • Chain 'D':
    Compound: ADP-ribosylation factor binding protein gga3
    Species: Homo sapiens [TaxId:9606]
    Gene: GGA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ52 (5-End)
      • modified residue (5)
      • modified residue (77)
      • modified residue (127)
      • modified residue (141)
      • cloning artifact (3-4)
    Domains in SCOPe 2.06: d1juqd1, d1juqd2
  • Chain 'E':
    Compound: Cation-dependent mannose-6-phosphate receptor
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Cation-dependent mannose-6-phosphate receptor
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Cation-dependent mannose-6-phosphate receptor
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Cation-dependent mannose-6-phosphate receptor
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1juqA (A:)
    gamgsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiq
    spqewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkvi
    ellyswtmalpeeakikdayhmlkrqgivqsdppipvdrtlipsppprpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1juqA (A:)
    esleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspqewealqal
    tvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviellyswtmalp
    eeakikdayhmlkrqgivqsdppipvdrtli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1juqB (B:)
    gamgsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiq
    spqewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkvi
    ellyswtmalpeeakikdayhmlkrqgivqsdppipvdrtlipsppprpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1juqB (B:)
    gsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspq
    ewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviell
    yswtmalpeeakikdayhmlkrqgivqsdppipvdrtli
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1juqC (C:)
    gamgsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiq
    spqewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkvi
    ellyswtmalpeeakikdayhmlkrqgivqsdppipvdrtlipsppprpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1juqC (C:)
    sleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspqewealqalt
    vleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviellyswtmalpe
    eakikdayhmlkrqgivqsdppipvdrtl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1juqD (D:)
    gamgsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiq
    spqewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkvi
    ellyswtmalpeeakikdayhmlkrqgivqsdppipvdrtlipsppprpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1juqD (D:)
    gsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspq
    ewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviell
    yswtmalpeeakikdayhmlkrqgivqsdppipvdrtli
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.