PDB entry 1jun

View 1jun on RCSB PDB site
Description: nmr study of c-jun homodimer
Class: transcription regulation
Keywords: transcription regulation, DNA-binding regulatory protein, oncogene protein, transcription activation
Deposited on 1995-12-19, released 1996-06-20
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-07-20.
Experiment type: NMR7
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-jun homodimer
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1juna_
  • Chain 'B':
    Compound: c-jun homodimer
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1junb_
  • Heterogens: ACE

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1junA (A:)
    cggriarleekvktlkaqnselastanmlreqvaqlkqkvmny
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1junB (B:)
    cggriarleekvktlkaqnselastanmlreqvaqlkqkvmny