PDB entry 1jul

View 1jul on RCSB PDB site
Description: indole-3-glycerolphosphate synthase from sulfolobus solfataricus in a second orthorhombic crystal form
Class: lyase
Keywords: thermophile, tim-barrel, tryptophan biosynthesis, lyase
Deposited on 1996-05-03, released 1997-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.176
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: indole-3-glycerol phosphate synthase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: TRPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jula_
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1julA (A:)
    mprylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaeykrkspsgl
    dverdpieyskfmeryavglsilteekyfngsyetlrkiassvsipilmkdfivkesqid
    daynlgadtvllivkiltereleslleyarsygmeplieindendldialrigarfigin
    srdletleinkenqrklismipsnvvkvaesgiserneieelrklgvnafligsslmrnp
    ekikefil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1julA (A:)
    prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaeykrkspsgld
    verdpieyskfmeryavglsilteekyfngsyetlrkiassvsipilmkdfivkesqidd
    aynlgadtvllivkiltereleslleyarsygmeplieindendldialrigarfigins
    rdletleinkenqrklismipsnvvkvaesgiserneieelrklgvnafligsslmrnpe
    kikefil