PDB entry 1juk

View 1juk on RCSB PDB site
Description: indole-3-glycerolphosphate synthase from sulfolobus solfataricus in a trigonal crystal form
Deposited on 1996-05-03, released 1997-07-07
The last revision prior to the SCOP 1.55 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.177
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1juk__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1juk_ (-)
    prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaeykrkspsgld
    verdpieyskfmeryavglsilteekyfngsyetlrkiassvsipilmkdfivkesqidd
    aynlgadtvllivkiltereleslleyarsygmeplieindendldialrigarfigins
    rdletleinkenqrklismipsnvvkvaesgiserneieelrklgvnafligsslmrnpe
    kikefil