PDB entry 1jub

View 1jub on RCSB PDB site
Description: The K136E mutant of lactococcus lactis dihydroorotate dehydrogenase A
Class: oxidoreductase
Keywords: homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase
Deposited on 2001-08-24, released 2003-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.191
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotate dehydrogenase a
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: PyrD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54321 (0-310)
      • engineered (135)
    Domains in SCOPe 2.07: d1juba_
  • Chain 'B':
    Compound: dihydroorotate dehydrogenase a
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: PyrD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54321 (0-310)
      • engineered (135)
    Domains in SCOPe 2.07: d1jubb_
  • Heterogens: MG, FMN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jubA (A:)
    mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
    lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
    sgitelnlscpnvpgepqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
    lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
    peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
    iadfhgklksl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jubB (B:)
    mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
    lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
    sgitelnlscpnvpgepqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
    lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
    peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
    iadfhgklksl