PDB entry 1ju9

View 1ju9 on RCSB PDB site
Description: horse liver alcohol dehydrogenase val292ser mutant
Class: oxidoreductase
Keywords: dehydrogenase, alcohol, nicotinamide coenzyme, oxidoreductase, mutant
Deposited on 2001-08-24, released 2001-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: Equus caballus [TaxId:9796]
    Gene: M64864
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00327 (0-373)
      • engineered (291)
    Domains in SCOPe 2.07: d1ju9a1, d1ju9a2
  • Chain 'B':
    Compound: alcohol dehydrogenase
    Species: Equus caballus [TaxId:9796]
    Gene: M64864
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00327 (0-373)
      • engineered (291)
    Domains in SCOPe 2.07: d1ju9b1, d1ju9b2
  • Heterogens: ZN, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ju9A (A:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvisgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ju9B (B:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvisgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf