PDB entry 1jts

View 1jts on RCSB PDB site
Description: dna protection and binding by e. coli dps protein
Deposited on 2001-08-22, released 2003-06-17
The last revision prior to the SCOP 1.69 freeze date was dated 2003-06-17, with a file datestamp of 2003-06-17.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.238
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1jtsa_
  • Chain 'B':
    Domains in SCOP 1.69: d1jtsb_
  • Chain 'C':
    Domains in SCOP 1.69: d1jtsc_
  • Chain 'D':
    Domains in SCOP 1.69: d1jtsd_
  • Chain 'E':
    Domains in SCOP 1.69: d1jtse_
  • Chain 'F':
    Domains in SCOP 1.69: d1jtsf_
  • Chain 'G':
    Domains in SCOP 1.69: d1jtsg_
  • Chain 'H':
    Domains in SCOP 1.69: d1jtsh_
  • Chain 'I':
    Domains in SCOP 1.69: d1jtsi_
  • Chain 'J':
    Domains in SCOP 1.69: d1jtsj_
  • Chain 'K':
    Domains in SCOP 1.69: d1jtsk_
  • Chain 'L':
    Domains in SCOP 1.69: d1jtsl_
  • Chain 'M':
    Domains in SCOP 1.69: d1jtsm_
  • Chain 'N':
    Domains in SCOP 1.69: d1jtsn_
  • Chain 'O':
    Domains in SCOP 1.69: d1jtso_
  • Chain 'P':
    Domains in SCOP 1.69: d1jtsp_
  • Chain 'Q':
    Domains in SCOP 1.69: d1jtsq_
  • Chain 'R':
    Domains in SCOP 1.69: d1jtsr_
  • Chain 'S':
    Domains in SCOP 1.69: d1jtss_
  • Chain 'T':
    Domains in SCOP 1.69: d1jtst_
  • Chain 'U':
    Domains in SCOP 1.69: d1jtsu_
  • Chain 'V':
    Domains in SCOP 1.69: d1jtsv_
  • Chain 'W':
    Domains in SCOP 1.69: d1jtsw_
  • Chain 'X':
    Domains in SCOP 1.69: d1jtsx_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jtsA (A:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsA (A:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jtsB (B:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsB (B:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jtsC (C:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsC (C:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    ichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jtsD (D:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsD (D:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    ichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1jtsE (E:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsE (E:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1jtsF (F:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsF (F:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1jtsG (G:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsG (G:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jtsH (H:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsH (H:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    ichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1jtsI (I:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsI (I:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    ichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1jtsJ (J:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsJ (J:)
    katnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgf
    rtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaiva
    ndvrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1jtsK (K:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsK (K:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    ichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1jtsL (L:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsL (L:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1jtsM (M:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsM (M:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1jtsN (N:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsN (N:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1jtsO (O:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsO (O:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1jtsP (P:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsP (P:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    ichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1jtsQ (Q:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsQ (Q:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    ichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1jtsR (R:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsR (R:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1jtsS (S:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsS (S:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1jtsT (T:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsT (T:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1jtsU (U:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsU (U:)
    atnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfr
    talichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivan
    dvrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1jtsV (V:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsV (V:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1jtsW (W:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsW (W:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1jtsX (X:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtsX (X:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie