PDB entry 1jtp

View 1jtp on RCSB PDB site
Description: Degenerate interfaces in antigen-antibody complexes
Class: Antibody, Hydrolase
Keywords: immunoglobulin, heavy chain antibody, VHH, interface, binding, Antibody, Hydrolase
Deposited on 2001-08-21, released 2001-12-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-Domain Antibody
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • GB 2392447 (0-End)
      • see remark 999 (133)
    Domains in SCOPe 2.06: d1jtpa_
  • Chain 'B':
    Compound: Single-Domain Antibody
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • GB 2392447 (0-End)
    Domains in SCOPe 2.06: d1jtpb_
  • Chain 'L':
    Compound: Lysozyme C
    Species: Meleagris gallopavo [TaxId:9103]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jtpl_
  • Chain 'M':
    Compound: Lysozyme C
    Species: Meleagris gallopavo [TaxId:9103]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jtpm_
  • Heterogens: NA, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jtpA (A:)
    dvqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityy
    adsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygy
    dswgqgtqvtvssrrypydvpdygsgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtpA (A:)
    dvqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityy
    adsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygy
    dswgqgtqvtvssrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jtpB (B:)
    dvqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityy
    adsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygy
    dswgqgtqvtvssrrypydvpdygsgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtpB (B:)
    dvqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityy
    adsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygy
    dswgqgtqvtvss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jtpL (L:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcrl
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jtpM (M:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcrl