PDB entry 1jtk

View 1jtk on RCSB PDB site
Description: crystal structure of cytidine deaminase from bacillus subtilis in complex with the inhibitor tetrahydrodeoxyuridine
Deposited on 2001-08-21, released 2002-04-10
The last revision prior to the SCOP 1.69 freeze date was dated 2002-04-10, with a file datestamp of 2002-04-10.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.207
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1jtka_
  • Chain 'B':
    Domains in SCOP 1.69: d1jtkb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jtkA (A:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcncaertalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedlhderkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtkA (A:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcncaertalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedlh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jtkB (B:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcncaertalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedlhderkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtkB (B:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcncaertalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedlh