PDB entry 1jta

View 1jta on RCSB PDB site
Description: Crystal Structure of Pectate Lyase A (C2 form)
Class: lyase
Keywords: parallel beta helix beta-elimination mechanism
Deposited on 2001-08-20, released 2002-06-19
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pectate lyase A
    Species: Erwinia chrysanthemi
    Gene: PELA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jtaa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jtaA (A:)
    aelvsdkalesaptvgwasqngfttggaaatsdniyivtniseftsalsagaeakiiqik
    gtidisggtpytdfadqkarsqinipanttviglgtdakfingsliidgtdgtnnviirn
    vyiqtpidvephyekgdgwnaewdamnitngahhvwidhvtisdgnftddmyttkdgety
    vqhdgaldikrgsdyvtisnslidqhdktmlighndtnsaqdkgklhvtlfnnvfnrvte
    raprvrygsihsfnnvfkgdakdpvyryqysfgigtsgsvlsegnsftianlsaskackv
    vkkfngsifsdngsvlngsavdlsgcgfsaytskipyiydvqpmttelaqsitdnagsgk
    l