PDB entry 1jt8

View 1jt8 on RCSB PDB site
Description: archaeal initiation factor-1a, aif-1a
Class: translation
Keywords: beta barrel, Translation factor
Deposited on 2001-08-20, released 2001-09-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable translation initiation factor 1a
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1jt8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jt8A (A:)
    maeqqqeqqirvriprkeeneilgiieqmlgasrvrvrcldgktrlgripgrlknriwvr
    egdvvivkpwevqgdqkcdiiwrytktqvewlkrkgyldell