PDB entry 1jt7

View 1jt7 on RCSB PDB site
Description: Human Acidic Fibroblast Growth Factor. 141 Amino Acid Form with Amino Terminal His Tag AND LEU 44 REPLACED BY PHE AND LEU 73 REPLACED BY VAL AND VAL 109 REPLACED BY LEU (L44F/L73V/V109L)
Class: hormone/growth factor
Keywords: beta-trefoil, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2001-08-20, released 2001-12-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.196
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (49)
      • engineered (78)
      • engineered (114)
    Domains in SCOPe 2.04: d1jt7a_
  • Chain 'B':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (49)
      • engineered (78)
      • engineered (114)
    Domains in SCOPe 2.04: d1jt7b_
  • Chain 'C':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (49)
      • engineered (78)
      • engineered (114)
    Domains in SCOPe 2.04: d1jt7c_
  • Chain 'D':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (49)
      • engineered (78)
      • engineered (114)
    Domains in SCOPe 2.04: d1jt7d_
  • Heterogens: SO4, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jt7A (A:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgev
    yikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jt7A (A:)
    hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyi
    kstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkngs
    ckrgprthygqkailflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jt7B (B:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgev
    yikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jt7B (B:)
    hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevy
    ikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkng
    sckrgprthygqkailflplpv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jt7C (C:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgev
    yikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jt7C (C:)
    hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyi
    kstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkngs
    ckrgprthygqkailflplpv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jt7D (D:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgev
    yikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jt7D (D:)
    hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevy
    ikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkng
    sckrgprthygqkailflplpv