PDB entry 1jt6

View 1jt6 on RCSB PDB site
Description: Crystal structure of the multidrug binding protein QacR bound to dequalinium
Deposited on 2001-08-20, released 2001-12-12
The last revision prior to the SCOP 1.61 freeze date was dated 2001-12-12, with a file datestamp of 2001-12-12.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.209
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jt6A (A:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jt6B (B:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jt6D (D:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jt6E (E:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls