PDB entry 1jt6

View 1jt6 on RCSB PDB site
Description: Crystal structure of the multidrug binding protein QacR bound to dequalinium
Class: transcription
Keywords: mutlidrug binding recognition, QacR, Mulitdrug resistance, S. aureus, TRANSCRIPTION
Deposited on 2001-08-20, released 2001-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.209
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical transcriptional regulator in qaca 5'region
    Species: Staphylococcus aureus [TaxId:1280]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.07: d1jt6a1, d1jt6a2
  • Chain 'B':
    Compound: hypothetical transcriptional regulator in qaca 5'region
    Species: Staphylococcus aureus [TaxId:1280]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.07: d1jt6b1, d1jt6b2
  • Chain 'D':
    Compound: hypothetical transcriptional regulator in qaca 5'region
    Species: Staphylococcus aureus [TaxId:1280]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.07: d1jt6d1, d1jt6d2
  • Chain 'E':
    Compound: hypothetical transcriptional regulator in qaca 5'region
    Species: Staphylococcus aureus [TaxId:1280]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.07: d1jt6e1, d1jt6e2
  • Heterogens: SO4, DEQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jt6A (A:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jt6A (A:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jt6B (B:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jt6B (B:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jt6D (D:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jt6D (D:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1jt6E (E:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jt6E (E:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls