PDB entry 1jt5

View 1jt5 on RCSB PDB site
Description: Human Acidic Fibroblast Growth Factor. 141 Amino Acid Form with Amino Terminal His Tag AND LEU 73 REPLACED BY VAL AND VAL 109 REPLACED BY LEU (L73V/V109L)
Class: hormone/growth factor
Keywords: beta-trefoil, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2001-08-20, released 2001-12-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.203
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (78)
      • engineered (114)
    Domains in SCOPe 2.04: d1jt5a_
  • Chain 'B':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (78)
      • engineered (114)
    Domains in SCOPe 2.04: d1jt5b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jt5A (A:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jt5A (A:)
    hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    ikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkng
    sckrgprthygqkailflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jt5B (B:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jt5B (B:)
    hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    ikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkng
    sckrgprthygqkailflplpv