PDB entry 1jt3

View 1jt3 on RCSB PDB site
Description: Human Acidic Fibroblast Growth Factor. 141 Amino Acid Form with Amino Histidine Tag AND LEU 73 REPLACED BY VAL (L73V)
Class: hormone/growth factor
Keywords: beta-trefoil, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2001-08-20, released 2001-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.219
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (78)
    Domains in SCOPe 2.07: d1jt3a1, d1jt3a2
  • Chain 'B':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (78)
    Domains in SCOPe 2.07: d1jt3b1, d1jt3b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jt3A (A:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jt3A (A:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsckrgprthygqkailflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jt3B (B:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jt3B (B:)
    hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    ikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
    sckrgprthygqkailflplpv