PDB entry 1jt1

View 1jt1 on RCSB PDB site
Description: FEZ-1 metallo-beta-lactamase from Legionella gormanii modelled with D-captopril
Class: hydrolase
Keywords: monomer with alpha-beta/beta-alpha fold, HYDROLASE
Deposited on 2001-08-20, released 2003-01-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.161
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FEZ-1, class B3 metallo-beta-lactamase
    Species: Fluoribacter gormanii [TaxId:464]
    Gene: blaFEZ-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K578 (Start-262)
      • see remark 999 (228)
      • see remark 999 (262)
    Domains in SCOPe 2.04: d1jt1a_
  • Heterogens: ZN, SO4, CL, MCO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jt1A (A:)
    aypmpnpfppfriagnlyyvgtddlasylivtprgnilinsdleanvpmikasikklgfk
    fsdtkillishahfdhaagselikqqtkakymvmdedvsvilsggksdfhyandsstyft
    qstvdkvlhdgervelggtvltahltpghtrgcttwtmklkdhgkqyqaviigsigvnpg
    yklvdnitypkiaedykhsikvlesmrcdiflgshagmfdlknkyvllskgqnnpfvdpt
    gcknyieqkandfytelkkqetg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jt1A (A:)
    ypmpnpfppfriagnlyyvgtddlasylivtprgnilinsdleanvpmikasikklgfkf
    sdtkillishahfdhaagselikqqtkakymvmdedvsvilsggksdfhyandsstyftq
    stvdkvlhdgervelggtvltahltpghtrgcttwtmklkdhgkqyqaviigsigvnpgy
    klvdnitypkiaedykhsikvlesmrcdiflgshagmfdlknkyvllskgqnnpfvdptg
    cknyieqkandfytelkkqetg