PDB entry 1jt0

View 1jt0 on RCSB PDB site
Description: Crystal structure of a cooperative QacR-DNA complex
Deposited on 2001-08-20, released 2002-03-08
The last revision prior to the SCOP 1.61 freeze date was dated 2002-03-08, with a file datestamp of 2002-03-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.222
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jt0A (A:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flnglskh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jt0B (B:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flnglskh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jt0C (C:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flnglskh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jt0D (D:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngl