PDB entry 1jt0

View 1jt0 on RCSB PDB site
Description: Crystal structure of a cooperative QacR-DNA complex
Class: transcription/DNA
Keywords: multidrug binding protein, cooperative DNA binding, dimer of dimers, TRANSCRIPTION/DNA COMPLEX
Deposited on 2001-08-20, released 2002-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.222
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical transcriptional regulator in qaca 5'region
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4 (Start-187)
      • engineered (71)
      • engineered (140)
      • expression tag (188)
    Domains in SCOPe 2.07: d1jt0a1, d1jt0a2, d1jt0a3
  • Chain 'B':
    Compound: hypothetical transcriptional regulator in qaca 5'region
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4 (Start-187)
      • engineered (71)
      • engineered (140)
      • expression tag (188)
    Domains in SCOPe 2.07: d1jt0b1, d1jt0b2, d1jt0b3
  • Chain 'C':
    Compound: hypothetical transcriptional regulator in qaca 5'region
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4 (Start-187)
      • engineered (71)
      • engineered (140)
      • expression tag (188)
    Domains in SCOPe 2.07: d1jt0c1, d1jt0c2, d1jt0c3
  • Chain 'D':
    Compound: hypothetical transcriptional regulator in qaca 5'region
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.07: d1jt0d1, d1jt0d2
  • Chain 'E':
    Compound: QACA operator
  • Chain 'F':
    Compound: QACA operator
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jt0A (A:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jt0A (A:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flnglskh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jt0B (B:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jt0B (B:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flnglskh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jt0C (C:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jt0C (C:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flnglskh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jt0D (D:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jt0D (D:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngl
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.