PDB entry 1jsy

View 1jsy on RCSB PDB site
Description: Crystal structure of bovine arrestin-2
Class: signaling protein
Keywords: Nonvisual arrestins, beta-arrestins, desensitization, endocytosis, down-regulation, SIGNALING PROTEIN
Deposited on 2001-08-19, released 2002-03-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.23
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bovine arrestin-2 (full length)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jsya1, d1jsya2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jsyA (A:)
    mgdkgtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltca
    frygredldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeip
    pnlpcsvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpgp
    qptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyad
    iclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnl
    asstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpkpkeep
    phrevpehetpvdtnlieldtndddivfedfarqrlkgmkddkeeeedgtgsprlndr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jsyA (A:)
    trvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafrygr
    edldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlpc
    svtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpgpqptae
    ttrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyadiclfn
    taqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnlasstl
    lreganreilgiivsykvkvklvvsssdvavelpftlmhpkdddivfedfarqrlkgm