PDB entry 1jsw

View 1jsw on RCSB PDB site
Description: native l-aspartate ammonia lyase
Deposited on 1997-02-19, released 1997-06-16
The last revision prior to the SCOP 1.57 freeze date was dated 1997-06-16, with a file datestamp of 1997-06-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1jswa_
  • Chain 'B':
    Domains in SCOP 1.57: d1jswb_
  • Chain 'C':
    Domains in SCOP 1.57: d1jswc_
  • Chain 'D':
    Domains in SCOP 1.57: d1jswd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jswA (A:)
    msnnirieedllgtrevpadayygvhtlraienfyisnnkisdipefvrgmvmvkkaaam
    ankelqtipksvanaiiaacdevlnngkcmdqfpvdvyqggagtsvnmntnevlanigle
    lmghqkgeyqylnpndhvnkcqstndayptgfriavyssliklvdainqlregferkave
    fqdilkmgrtqlqdavpmtlgqefrafsillkeevkniqrtaelllevnlgataigtgln
    tpkeysplavkklaevtgfpcvpaedlieatsdcgayvmvhgalkrlavkmskicndlrl
    lssgpraglneinlpelqagssimpakvnpvvpevvnqvcfkvigndttvtmaaeagqlq
    lnvmepvigqamfesvhiltnacynllekcingitankevcegyvynsigivtylnpfig
    hhngdivgkicaetgksvrevvlergllteaelddifsv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jswB (B:)
    msnnirieedllgtrevpadayygvhtlraienfyisnnkisdipefvrgmvmvkkaaam
    ankelqtipksvanaiiaacdevlnngkcmdqfpvdvyqggagtsvnmntnevlanigle
    lmghqkgeyqylnpndhvnkcqstndayptgfriavyssliklvdainqlregferkave
    fqdilkmgrtqlqdavpmtlgqefrafsillkeevkniqrtaelllevnlgataigtgln
    tpkeysplavkklaevtgfpcvpaedlieatsdcgayvmvhgalkrlavkmskicndlrl
    lssgpraglneinlpelqagssimpakvnpvvpevvnqvcfkvigndttvtmaaeagqlq
    lnvmepvigqamfesvhiltnacynllekcingitankevcegyvynsigivtylnpfig
    hhngdivgkicaetgksvrevvlergllteaelddifsvq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jswC (C:)
    irieedllgtrevpadayygvhtlraienfyisnnkisdipefvrgmvmvkkaaamanke
    lqtipksvanaiiaacdevlnngkcmdqfpvdvyqggagtsvnmntnevlaniglelmgh
    qkgeyqylnpndhvnkcqstndayptgfriavyssliklvdainqlregferkavefqdi
    lkmgrtqlqdavpmtlgqefrafsillkeevkniqrtaelllevnlgataigtglntpke
    ysplavkklaevtgfpcvpaedlieatsdcgayvmvhgalkrlavkmskicndlrllssg
    praglneinlpelqagssimpakvnpvvpevvnqvcfkvigndttvtmaaeagqlqlnvm
    epvigqamfesvhiltnacynllekcingitankevcegyvynsigivtylnp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jswD (D:)
    msnnirieedllgtrevpadayygvhtlraienfyisnnkisdipefvrgmvmvkkaaam
    ankelqtipksvanaiiaacdevlnngkcmdqfpvdvyqggagtsvnmntnevlanigle
    lmghqkgeyqylnpndhvnkcqstndayptgfriavyssliklvdainqlregferkave
    fqdilkmgrtqlqdavpmtlgqefrafsillkeevkniqrtaelllevnlgataigtgln
    tpkeysplavkklaevtgfpcvpaedlieatsdcgayvmvhgalkrlavkmskicndlrl
    lssgpraglneinlpelqagssimpakvnpvvpevvnqvcfkvigndttvtmaaeagqlq
    lnvmepvigqamfesvhiltnacynllekcingitankevcegyvynsigivtylnpfig
    hhngdivgkicaetgksvrevvlergllteaelddifsv