PDB entry 1jss

View 1jss on RCSB PDB site
Description: Crystal structure of the Mus musculus cholesterol-regulated START protein 4 (StarD4).
Class: lipid binding protein
Keywords: START domain, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, LIPID BINDING PROTEIN
Deposited on 2001-08-17, released 2002-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cholesterol-regulated START protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: BC005642; Unigene Cluster: Mm. 31508
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99JV5
      • see remark 999 (40)
      • see remark 999 (50)
    Domains in SCOPe 2.08: d1jssa_
  • Chain 'B':
    Compound: cholesterol-regulated START protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: BC005642; Unigene Cluster: Mm. 31508
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99JV5
      • see remark 999 (40)
      • see remark 999 (50)
    Domains in SCOPe 2.08: d1jssb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jssA (A:)
    madpespwsqigrkikleglsdvasistklqntliqyhsieedewrvakkakdvtvwrkp
    seefngylykaqgvmddvvnnvidhirpgpwrldwdrlmtsldvlehfeenccvmrytta
    gqllniisprefvdfsytvgyeegllscgvsvewsetrpefvrgynhpcgwfcvplkdsp
    sqslltgyiqtdlrgmipqsavdtamastlanfysdlrkglrka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jssA (A:)
    asistklqntliqyhsieedewrvakkakdvtvwrkpseefngylykaqgvmddvvnnvi
    dhirpgpwrldwdrlmtsldvlehfeenccvmryttagqllniisprefvdfsytvgyee
    gllscgvsvewsetrpefvrgynhpcgwfcvplkdspsqslltgyiqtdlrgmipqsavd
    tamastlanfysdlrkglr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jssB (B:)
    madpespwsqigrkikleglsdvasistklqntliqyhsieedewrvakkakdvtvwrkp
    seefngylykaqgvmddvvnnvidhirpgpwrldwdrlmtsldvlehfeenccvmrytta
    gqllniisprefvdfsytvgyeegllscgvsvewsetrpefvrgynhpcgwfcvplkdsp
    sqslltgyiqtdlrgmipqsavdtamastlanfysdlrkglrka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jssB (B:)
    asistklqntliqyhsieedewrvakkakdvtvwrkpseefngylykaqgvmddvvnnvi
    dhirpgpwrldwdrlmtsldvlehfeenccvmryttagqllniisprefvdfsytvgyee
    gllscgvsvewsetrpefvrgynhpcgwfcvplkdspsqslltgyiqtdlrgmipqsavd
    tamastlanfysdlrkglr