PDB entry 1jsr

View 1jsr on RCSB PDB site
Description: crystal structure of erwinia chrysanthemi l-asparaginase complexed with 6-hydroxy-l-norleucine
Class: hydrolase
Keywords: asparaginase, hydrolase, covalent complex, 6-diazo-5-oxo-l-norleucine
Deposited on 2001-08-17, released 2002-01-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-asparaginase
    Species: Erwinia chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06608 (Start-326)
      • variant (155)
      • variant (177)
      • variant (266)
      • variant (273)
    Domains in SCOPe 2.06: d1jsra_
  • Chain 'B':
    Compound: L-asparaginase
    Species: Erwinia chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06608 (Start-326)
      • variant (155)
      • variant (177)
      • variant (266)
      • variant (273)
    Domains in SCOPe 2.06: d1jsrb_
  • Chain 'C':
    Compound: L-asparaginase
    Species: Erwinia chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06608 (Start-326)
      • variant (155)
      • variant (177)
      • variant (266)
      • variant (273)
    Domains in SCOPe 2.06: d1jsrc_
  • Chain 'D':
    Compound: L-asparaginase
    Species: Erwinia chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06608 (Start-326)
      • variant (155)
      • variant (177)
      • variant (266)
      • variant (273)
    Domains in SCOPe 2.06: d1jsrd_
  • Heterogens: LDO, 1PE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jsrA (A:)
    adklpnivilatggtiagsaatgtqttgykagalgvdtlinavpevkklanvkgeqfsnm
    asenmtgdvvlklsqrvnellarddvdgvvithgtdtveesayflhltvksdkpvvfvaa
    mrpataisadgpmnlleavrvagdkqsrgrgvmvvindrigsaryitktnastldtfran
    eegylgviignriyyqnridklhttrsvfdvrgltslpkvdilygyqddpeylydaaiqh
    gvkgivyagmgagsvsvrgiagmrkalekgvvvmrstrtgngivppdeelpglvsdslnp
    aharillmlaltrtsdpkviqeyfhty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jsrA (A:)
    lpnivilatggtiagsaatgtqttgykagalgvdtlinavpevkklanvkgeqfsnmase
    nmtgdvvlklsqrvnellarddvdgvvithgtdtveesayflhltvksdkpvvfvaamrp
    ataisadgpmnlleavrvagdkqsrgrgvmvvindrigsaryitktnastldtfraneeg
    ylgviignriyyqnridklhttrsvfdvrgltslpkvdilygyqddpeylydaaiqhgvk
    givyagmgagsvsvrgiagmrkalekgvvvmrstrtgngivppdeelpglvsdslnpaha
    rillmlaltrtsdpkviqeyfhty
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jsrB (B:)
    adklpnivilatggtiagsaatgtqttgykagalgvdtlinavpevkklanvkgeqfsnm
    asenmtgdvvlklsqrvnellarddvdgvvithgtdtveesayflhltvksdkpvvfvaa
    mrpataisadgpmnlleavrvagdkqsrgrgvmvvindrigsaryitktnastldtfran
    eegylgviignriyyqnridklhttrsvfdvrgltslpkvdilygyqddpeylydaaiqh
    gvkgivyagmgagsvsvrgiagmrkalekgvvvmrstrtgngivppdeelpglvsdslnp
    aharillmlaltrtsdpkviqeyfhty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jsrB (B:)
    lpnivilatggtiagsaatgtqttgykagalgvdtlinavpevkklanvkgeqfsnmase
    nmtgdvvlklsqrvnellarddvdgvvithgtdtveesayflhltvksdkpvvfvaamrp
    ataisadgpmnlleavrvagdkqsrgrgvmvvindrigsaryitktnastldtfraneeg
    ylgviignriyyqnridklhttrsvfdvrgltslpkvdilygyqddpeylydaaiqhgvk
    givyagmgagsvsvrgiagmrkalekgvvvmrstrtgngivppdeelpglvsdslnpaha
    rillmlaltrtsdpkviqeyfhty
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jsrC (C:)
    adklpnivilatggtiagsaatgtqttgykagalgvdtlinavpevkklanvkgeqfsnm
    asenmtgdvvlklsqrvnellarddvdgvvithgtdtveesayflhltvksdkpvvfvaa
    mrpataisadgpmnlleavrvagdkqsrgrgvmvvindrigsaryitktnastldtfran
    eegylgviignriyyqnridklhttrsvfdvrgltslpkvdilygyqddpeylydaaiqh
    gvkgivyagmgagsvsvrgiagmrkalekgvvvmrstrtgngivppdeelpglvsdslnp
    aharillmlaltrtsdpkviqeyfhty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jsrC (C:)
    lpnivilatggtiagsaatgtqttgykagalgvdtlinavpevkklanvkgeqfsnmase
    nmtgdvvlklsqrvnellarddvdgvvithgtdtveesayflhltvksdkpvvfvaamrp
    ataisadgpmnlleavrvagdkqsrgrgvmvvindrigsaryitktnastldtfraneeg
    ylgviignriyyqnridklhttrsvfdvrgltslpkvdilygyqddpeylydaaiqhgvk
    givyagmgagsvsvrgiagmrkalekgvvvmrstrtgngivppdeelpglvsdslnpaha
    rillmlaltrtsdpkviqeyfhty
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jsrD (D:)
    adklpnivilatggtiagsaatgtqttgykagalgvdtlinavpevkklanvkgeqfsnm
    asenmtgdvvlklsqrvnellarddvdgvvithgtdtveesayflhltvksdkpvvfvaa
    mrpataisadgpmnlleavrvagdkqsrgrgvmvvindrigsaryitktnastldtfran
    eegylgviignriyyqnridklhttrsvfdvrgltslpkvdilygyqddpeylydaaiqh
    gvkgivyagmgagsvsvrgiagmrkalekgvvvmrstrtgngivppdeelpglvsdslnp
    aharillmlaltrtsdpkviqeyfhty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jsrD (D:)
    lpnivilatggtiagsaatgtqttgykagalgvdtlinavpevkklanvkgeqfsnmase
    nmtgdvvlklsqrvnellarddvdgvvithgtdtveesayflhltvksdkpvvfvaamrp
    ataisadgpmnlleavrvagdkqsrgrgvmvvindrigsaryitktnastldtfraneeg
    ylgviignriyyqnridklhttrsvfdvrgltslpkvdilygyqddpeylydaaiqhgvk
    givyagmgagsvsvrgiagmrkalekgvvvmrstrtgngivppdeelpglvsdslnpaha
    rillmlaltrtsdpkviqeyfhty