PDB entry 1jsp

View 1jsp on RCSB PDB site
Description: NMR Structure of CBP Bromodomain in complex with p53 peptide
Class: DNA binding protein
Keywords: Bromodomain, CBP, NMR structure., DNA BINDING PROTEIN
Deposited on 2001-08-17, released 2002-08-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor protein p53
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637 (0-19)
      • modified residue (15)
  • Chain 'B':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92793 (4-120)
      • cloning artifact (0-3)
    Domains in SCOPe 2.05: d1jspb_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jspB (B:)
    gshmrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdls
    tikrkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
    g