PDB entry 1jsn

View 1jsn on RCSB PDB site
Description: structure of avian h5 haemagglutinin complexed with lsta receptro analog
Class: Viral protein
Keywords: influenza, receptor complex, fusion protein, Viral protein
Deposited on 2001-08-17, released 2001-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.24
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haemagglutinin (ha1 chain)
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jsna_
  • Chain 'B':
    Compound: haemagglutinin (ha2 chain)
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1JSN (0-End)
    Domains in SCOPe 2.07: d1jsnb_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jsnA (A:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcsvagw
    llgnpmcdeflnvpewsyivekdnpvnglcypenfndyeelkhllsstnhfekiriiprs
    swsnhdassgvssacpyngrssffrnvvwlikknnayptikrsynntnqedllilwgihh
    pndaaeqtklyqnpttyvsvgtstlnqrsvpeiatrpkvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkggsaimksgleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksgrlvlatglrnvpqret
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jsnA (A:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcsvagw
    llgnpmcdeflnvpewsyivekdnpvnglcypenfndyeelkhllsstnhfekiriiprs
    swsnhdassgvssacpyngrssffrnvvwlikknnayptikrsynntnqedllilwgihh
    pndaaeqtklyqnpttyvsvgtstlnqrsvpeiatrpkvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkggsaimksgleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksgrlvlatglrnvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jsnB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgttnkvnsiidkmn
    tqfeavgkefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreeisgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jsnB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgttnkvnsiidkmn
    tqfeavgkefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydyp