PDB entry 1jsk

View 1jsk on RCSB PDB site
Description:
Deposited on 2001-08-17, released 2002-02-20
The last revision prior to the SCOP 1.63 freeze date was dated 2002-02-20, with a file datestamp of 2002-02-20.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.314
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1jska_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1jskb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1jskc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jskA (A:)
    gycgpcpnnwichrnncyqffneektwnqsqasclsqnssllkiyskeeqdflklvksyh
    wmglvqipangswqwedgsslsynqltlveipkgscavygssfkaytedcanlntyicmk
    rav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jskB (B:)
    gycgpcpnnwichrnncyqffneektwnqsqasclsqnssllkiyskeeqdflklvksyh
    wmglvqipangswqwedgsslsynqltlveipkgscavygssfkaytedcanlntyicmk
    rav
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jskC (C:)
    dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
    ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
    tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek