PDB entry 1jsi

View 1jsi on RCSB PDB site
Description: crystal structure of h9 haemagglutinin bound to lstc receptor analog
Class: Viral protein
Keywords: influenza, receptor complex, fusion protein, Viral protein
Deposited on 2001-08-17, released 2001-09-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.202
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haemagglutinin (ha1 chain)
    Species: Influenza A virus (A/swine/Hong Kong/9/98(H9N2)) [TaxId:145307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1jsia_
  • Chain 'B':
    Compound: haemagglutinin (ha2 chain)
    Species: Influenza A virus (A/swine/Hong Kong/9/98(H9N2)) [TaxId:145307]
    Database cross-references and differences (RAF-indexed):
    • PDB 1JSI (0-End)
    Domains in SCOPe 2.05: d1jsib_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jsiA (A:)
    dkicigyqstnstetvdtltetnvpvthakellhtshngmlcatnlghplildtctiegl
    iygnpscdlllggrewsyiverpsavngmcypgnvenleelrslfssassyqriqifpdt
    iwnvsysgtssacsdsfyrsmrwltqknnaypiqdaqytnnrgksilfmwginhpptdtv
    qtnlytrtdtttsvttedinrtfkpvigprplvnglhgridyywsvlkpgqtlrvrsngn
    liapwyghilsgeshgrilktdlnsgncvvqcqtergglnttlpfhnvskyafgncpkyv
    gvkslklavglrnvparss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jsiA (A:)
    dkicigyqstnstetvdtltetnvpvthakellhtshngmlcatnlghplildtctiegl
    iygnpscdlllggrewsyiverpsavngmcypgnvenleelrslfssassyqriqifpdt
    iwnvsysgtssacsdsfyrsmrwltqknnaypiqdaqytnnrgksilfmwginhpptdtv
    qtnlytrtdtttsvttedinrtfkpvigprplvnglhgridyywsvlkpgqtlrvrsngn
    liapwyghilsgeshgrilktdlnsgncvvqcqtergglnttlpfhnvskyafgncpkyv
    gvkslklavglrnvpar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jsiB (B:)
    glfgaiagfieggwpglvagwygfqhsndqgvgmaadsdstqkaidkitskvnnivdkmn
    kqygiidhefseietrlnminnkiddqiqdiwtynaellvllenqktldehdanvnnlyn
    kvkralgsnamedgkgcfelyhkcddqcmetirngtynrrkykeesklerqkiegi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jsiB (B:)
    glfgaiagfieggwpglvagwygfqhsndqgvgmaadsdstqkaidkitskvnnivdkmn
    kqygiidhefseietrlnminnkiddqiqdiwtynaellvllenqktldehdanvnnlyn
    kvkralgsnamedgkgcfelyhkcddqcmetirngtynrr