PDB entry 1jsg

View 1jsg on RCSB PDB site
Description: crystal structure of p14tcl1, an oncogene product involved in T-cell prolymphocytic leukemia, reveals a novel b-barrel topology
Class: proto-oncogene
Keywords: proto-oncogene, cl1 gene, t cell leukemia, oncoprotein, microsome
Deposited on 1997-12-03, released 1998-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.192
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oncogene product p14tcl1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jsga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jsgA (A:)
    maecptlgeavtdhpdrlwawekfvyldekqhawlpltieikdrlqlrvllrredvvlgr
    pmtptqigpsllpimwqlypdgryrssdssfwrlvyhikidgvedmllellpdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jsgA (A:)
    cptlgeavtdhpdrlwawekfvyldekqhawlpltieikdrlqlrvllrredvvlgrpmt
    ptqigpsllpimwqlypdgryrssdssfwrlvyhikidgvedmllellpdd