PDB entry 1jsc

View 1jsc on RCSB PDB site
Description: Crystal Structure of the Catalytic Subunit of Yeast Acetohydroxyacid Synthase: A target for Herbicidal Inhibitors
Deposited on 2001-08-17, released 2002-01-16
The last revision prior to the SCOP 1.63 freeze date was dated 2002-03-27, with a file datestamp of 2002-03-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.188
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jscA (A:)
    pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga
    ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq
    eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi
    ptkttlpsnalnqltsraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllke
    lsdraqipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvt
    gniskfapearraaaegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvk
    ersewfaqinkwkkeypyaymeetpgskikpqtvikklskvandtgrhvivttgvgqhqm
    waaqhwtwrnphtfitsgglgtmgyglpaaigaqvakpeslvididgdasfnmtltelss
    avqagtpvkililnneeqgmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkq
    eeldaklkefvstkgpvllevevdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jscA (A:)
    pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga
    ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq
    eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi
    ptkttlpsaqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipv
    tttlqglgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfape
    arraaaegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqi
    nkwkkeypyaymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwr
    nphtfitsgglgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvk
    ililnneeshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvllevevdk
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jscB (B:)
    epdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqg
    aghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdaf
    qeadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnp
    iptkttlpsnalnqltsraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllk
    elsdraqipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrv
    tgniskfapearraaaegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpv
    kersewfaqinkwkkeypyaymeetpgskikpqtvikklskvandtgrhvivttgvgqhq
    mwaaqhwtwrnphtfitsgglgtmgyglpaaigaqvakpeslvididgdasfnmtltels
    savqagtpvkililnneeqgmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkk
    qeeldaklkefvstkgpvllevevdkkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jscB (B:)
    epdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqg
    aghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdaf
    qeadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnp
    iptkttlpsnaltsraqdefvmqsinkaadlinlakpvlyvgagilnhadgprllkelsd
    raqipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgni
    skfapearraaiihfevspkninkvvqtqiavegdattnlgkmmskifpvrsewfaqink
    wkkeyeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfit
    sgglgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnne
    eqgmvtqwqslfehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpv
    llevevdkkv