PDB entry 1jsa

View 1jsa on RCSB PDB site
Description: myristoylated recoverin with two calciums bound, nmr, 24 structures
Deposited on 1997-06-04, released 1997-10-15
The last revision prior to the SCOP 1.57 freeze date was dated 1997-10-15, with a file datestamp of 1997-10-15.
Experiment type: NMR24
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1jsa__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jsa_ (-)
gnsksgalskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpead
pkayaqhvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtiskne
vleivtaifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlanke
ilrliqfe