PDB entry 1js6

View 1js6 on RCSB PDB site
Description: Crystal Structure of DOPA decarboxylase
Class: lyase
Keywords: DOPA decarboxylase, carbiDOPA, Parkinson's disease, Vitamin B6, LYASE
Deposited on 2001-08-16, released 2001-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.206
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DOPA decarboxylase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1js6a_
  • Chain 'B':
    Compound: DOPA decarboxylase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1js6b_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1js6A (A:)
    mnasdfrrrgkemvdymadylegiegrqvypdvqpgylrplipatapqepdtfedilqdv
    ekiimpgvthwhspyffayfptassypamladmlcgaigcigfswaaspacteletvmmd
    wlgkmlqlpeaflageagegggviqgsaseatlvallaartkvvrrlqaaspgltqgavl
    eklvayasdqahssveragliggvklkaipsdgkfamrasalqealerdkaaglipffvv
    atlgttsccsfdnllevgpicheediwlhvdaayagsaficpefrhllngvefadsfnfn
    phkwllvnfdcsamwvkrrtdltgafkldpvylkhshqgsglitdyrhwqlplgrrfrsl
    kmwfvfrmygvkglqayirkhvqlshefeafvlqdprfevcaevtlglvcfrlkgsdgln
    eallerinsarkihlvpcrlrgqfvlrfaicsrkvesghvrlawehirglaaellaaeeg
    kaeiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1js6A (A:)
    mnasdfrrrgkemvdymadylegiegrqvypdvqpgylrplipatapqepdtfedilqdv
    ekiimpgvthwhspyffayfptassypamladmlcgaigcigfswaaspacteletvmmd
    wlgkmlqlpeaflageagegggviqgsaseatlvallaartkvvrrlqaaspgltqgavl
    eklvayasdqahssveragliggvklkaipsdgkfamrasalqealerdkaaglipffvv
    atlgttsccsfdnllevgpicheediwlhvdaayagsaficpefrhllngvefadsfnfn
    phkwllvnfdcsamwvkrrtdltgafksglitdyrhwqlplgrrfrslkmwfvfrmygvk
    glqayirkhvqlshefeafvlqdprfevcaevtlglvcfrlkgsdglneallerinsark
    ihlvpcrlrgqfvlrfaicsrkvesghvrlawehirglaaella
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1js6B (B:)
    mnasdfrrrgkemvdymadylegiegrqvypdvqpgylrplipatapqepdtfedilqdv
    ekiimpgvthwhspyffayfptassypamladmlcgaigcigfswaaspacteletvmmd
    wlgkmlqlpeaflageagegggviqgsaseatlvallaartkvvrrlqaaspgltqgavl
    eklvayasdqahssveragliggvklkaipsdgkfamrasalqealerdkaaglipffvv
    atlgttsccsfdnllevgpicheediwlhvdaayagsaficpefrhllngvefadsfnfn
    phkwllvnfdcsamwvkrrtdltgafkldpvylkhshqgsglitdyrhwqlplgrrfrsl
    kmwfvfrmygvkglqayirkhvqlshefeafvlqdprfevcaevtlglvcfrlkgsdgln
    eallerinsarkihlvpcrlrgqfvlrfaicsrkvesghvrlawehirglaaellaaeeg
    kaeiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1js6B (B:)
    mnasdfrrrgkemvdymadylegiegrqvypdvqpgylrplipatapqepdtfedilqdv
    ekiimpgvthwhspyffayfptassypamladmlcgaigcigfswaaspacteletvmmd
    wlgkmlqlpeaflageagegggviqgsaseatlvallaartkvvrrlqaaspgltqgavl
    eklvayasdqahssveragliggvklkaipsdgkfamrasalqealerdkaaglipffvv
    atlgttsccsfdnllevgpicheediwlhvdaayagsaficpefrhllngvefadsfnfn
    phkwllvnfdcsamwvkrrtdltgafksglitdyrhwqlplgrrfrslkmwfvfrmygvk
    glqayirkhvqlshefeafvlqdprfevcaevtlglvcfrlkgsdglneallerinsark
    ihlvpcrlrgqfvlrfaicsrkvesghvrlawehirglaaella