PDB entry 1js4

View 1js4 on RCSB PDB site
Description: endo/exocellulase:cellobiose from thermomonospora
Deposited on 1997-05-30, released 1997-09-17
The last revision prior to the SCOP 1.55 freeze date was dated 1997-09-17, with a file datestamp of 1997-09-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1js4A (A:)
    epafnyaealqksmffyeaqrsgklpennrvswrgdsglndgadvgldltggwydagdhv
    kfgfpmaftatmlawgaiespegyirsgqmpylkdnlrwvndyfikahpspnvlyvqvgd
    gdadhkwwgpaevmpmerpsfkvdpscpgsdvaaetaaamaassivfadddpayaatlvq
    hakqlytfadtyrgvysdcvpagafynswsgyqdelvwgaywlykatgddsylakaeyey
    dflsteqqtdlrsyrwtiawddksygtyvllaketgkqkyiddanrwldywtvgvngqrv
    pyspggmavldtwgalryaantafvalvyakviddpvrkqryhdfavrqinyalgdnprn
    ssyvvgfgnnpprnphhrtahgswtdsiaspaenrhvlygalvggpgspndaytddrqdy
    vanevatdynagfssalamlveeyggtpladfppteepdgpeifveaqintpgttfteik
    amirnqsgwparmldkgtfrywftldegvdpaditvssaynqcatpedvhhvsgdlyyve
    idctgekifpggqsehrrevqfriaggpgwdpsndwsfqgignelapapyivlyddgvpv
    wgtap
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1js4B (B:)
    epafnyaealqksmffyeaqrsgklpennrvswrgdsglndgadvgldltggwydagdhv
    kfgfpmaftatmlawgaiespegyirsgqmpylkdnlrwvndyfikahpspnvlyvqvgd
    gdadhkwwgpaevmpmerpsfkvdpscpgsdvaaetaaamaassivfadddpayaatlvq
    hakqlytfadtyrgvysdcvpagafynswsgyqdelvwgaywlykatgddsylakaeyey
    dflsteqqtdlrsyrwtiawddksygtyvllaketgkqkyiddanrwldywtvgvngqrv
    pyspggmavldtwgalryaantafvalvyakviddpvrkqryhdfavrqinyalgdnprn
    ssyvvgfgnnpprnphhrtahgswtdsiaspaenrhvlygalvggpgspndaytddrqdy
    vanevatdynagfssalamlveeyggtpladfppteepdgpeifveaqintpgttfteik
    amirnqsgwparmldkgtfrywftldegvdpaditvssaynqcatpedvhhvsgdlyyve
    idctgekifpggqsehrrevqfriaggpgwdpsndwsfqgignelapapyivlyddgvpv
    wgtap