PDB entry 1js3

View 1js3 on RCSB PDB site
Description: Crystal structure of dopa decarboxylase in complex with the inhibitor carbidopa
Deposited on 2001-08-16, released 2001-10-26
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-26, with a file datestamp of 2001-10-26.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.144
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1js3a_
  • Chain 'B':
    Domains in SCOP 1.59: d1js3b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1js3A (A:)
    mnasdfrrrgkemvdymadylegiegrqvypdvqpgylrplipatapqepdtfedilqdv
    ekiimpgvthwhspyffayfptassypamladmlcgaigcigfswaaspacteletvmmd
    wlgkmlqlpeaflageagegggviqgsaseatlvallaartkvvrrlqaaspgltqgavl
    eklvayasdqahssveragliggvklkaipsdgkfamrasalqealerdkaaglipffvv
    atlgttsccsfdnllevgpicheediwlhvdaayagsaficpefrhllngvefadsfnfn
    phkwllvnfdcsamwvkrrtdltgafkldpvylkhshqgsglitdyrhwqlplgrrfrsl
    kmwfvfrmygvkglqayirkhvqlshefeafvlqdprfevcaevtlglvcfrlkgsdgln
    eallerinsarkihlvpcrlrgqfvlrfaicsrkvesghvrlawehirglaaella
    

    Sequence, based on observed residues (ATOM records): (download)
    >1js3A (A:)
    mnasdfrrrgkemvdymadylegiegrqvypdvqpgylrplipatapqepdtfedilqdv
    ekiimpgvthwhspyffayfptassypamladmlcgaigcigfswaaspacteletvmmd
    wlgkmlqlpeaflageagegggviqgsaseatlvallaartkvvrrlqaaspgltqgavl
    eklvayasdqahssveragliggvklkaipsdgkfamrasalqealerdkaaglipffvv
    atlgttsccsfdnllevgpicheediwlhvdaayagsaficpefrhllngvefadsfnfn
    phkwllvnfdcsamwvkrrtdltgafksglitdyrhwqlplgrrfrslkmwfvfrmygvk
    glqayirkhvqlshefeafvlqdprfevcaevtlglvcfrlkgsdglneallerinsark
    ihlvpcrlrgqfvlrfaicsrkvesghvrlawehirglaaella
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1js3B (B:)
    mnasdfrrrgkemvdymadylegiegrqvypdvqpgylrplipatapqepdtfedilqdv
    ekiimpgvthwhspyffayfptassypamladmlcgaigcigfswaaspacteletvmmd
    wlgkmlqlpeaflageagegggviqgsaseatlvallaartkvvrrlqaaspgltqgavl
    eklvayasdqahssveragliggvklkaipsdgkfamrasalqealerdkaaglipffvv
    atlgttsccsfdnllevgpicheediwlhvdaayagsaficpefrhllngvefadsfnfn
    phkwllvnfdcsamwvkrrtdltgafkldpvylkhshqgsglitdyrhwqlplgrrfrsl
    kmwfvfrmygvkglqayirkhvqlshefeafvlqdprfevcaevtlglvcfrlkgsdgln
    eallerinsarkihlvpcrlrgqfvlrfaicsrkvesghvrlawehirglaaella
    

    Sequence, based on observed residues (ATOM records): (download)
    >1js3B (B:)
    mnasdfrrrgkemvdymadylegiegrqvypdvqpgylrplipatapqepdtfedilqdv
    ekiimpgvthwhspyffayfptassypamladmlcgaigcigfswaaspacteletvmmd
    wlgkmlqlpeaflageagegggviqgsaseatlvallaartkvvrrlqaaspgltqgavl
    eklvayasdqahssveragliggvklkaipsdgkfamrasalqealerdkaaglipffvv
    atlgttsccsfdnllevgpicheediwlhvdaayagsaficpefrhllngvefadsfnfn
    phkwllvnfdcsamwvkrrtdltgafksglitdyrhwqlplgrrfrslkmwfvfrmygvk
    glqayirkhvqlshefeafvlqdprfevcaevtlglvcfrlkgsdglneallerinsark
    ihlvpcrlrgqfvlrfaicsrkvesghvrlawehirglaaella