PDB entry 1js2

View 1js2 on RCSB PDB site
Description: Crystal structure of C77S HiPIP: a serine ligated [4Fe-4S] cluster
Class: electron transport
Keywords: serine ligated [4Fe-4S] cluster, ELECTRON TRANSPORT
Deposited on 2001-08-16, released 2002-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high-potential iron protein
    Species: Allochromatium vinosum [TaxId:1049]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00260
      • cloning artifact (0-3)
      • engineered (80)
    Domains in SCOPe 2.06: d1js2a1, d1js2a2
  • Chain 'B':
    Compound: high-potential iron protein
    Species: Allochromatium vinosum [TaxId:1049]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00260
      • cloning artifact (0-3)
      • engineered (80)
    Domains in SCOPe 2.06: d1js2b1, d1js2b2
  • Chain 'C':
    Compound: high-potential iron protein
    Species: Allochromatium vinosum [TaxId:1049]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00260
      • cloning artifact (0-3)
      • engineered (80)
    Domains in SCOPe 2.06: d1js2c1, d1js2c2
  • Chain 'D':
    Compound: high-potential iron protein
    Species: Allochromatium vinosum [TaxId:1049]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00260 (4-88)
      • cloning artifact (0-3)
      • engineered (80)
    Domains in SCOPe 2.06: d1js2d1, d1js2d2
  • Heterogens: SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1js2A (A:)
    mefmsapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaaga
    tdewkgcqlfpgklinvngwsaswtlkag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1js2B (B:)
    mefmsapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaaga
    tdewkgcqlfpgklinvngwsaswtlkag
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1js2C (C:)
    mefmsapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaaga
    tdewkgcqlfpgklinvngwsaswtlkag
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1js2D (D:)
    mefmsapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaaga
    tdewkgcqlfpgklinvngwsaswtlkag