PDB entry 1js2

View 1js2 on RCSB PDB site
Description: Crystal structure of C77S HiPIP: a serine ligated [4Fe-4S] cluster
Class: electron transport
Keywords: serine ligated [4Fe-4S] cluster, ELECTRON TRANSPORT
Deposited on 2001-08-16, released 2002-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: high-potential iron protein
  Species: Allochromatium vinosum [TaxId:1049]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00260
    • cloning artifact (0-3)
    • engineered (80)
  Domains in SCOPe 2.06: d1js2a1, d1js2a2
• Chain 'B':
  Compound: high-potential iron protein
  Species: Allochromatium vinosum [TaxId:1049]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00260
    • cloning artifact (0-3)
    • engineered (80)
  Domains in SCOPe 2.06: d1js2b1, d1js2b2
• Chain 'C':
  Compound: high-potential iron protein
  Species: Allochromatium vinosum [TaxId:1049]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00260
    • cloning artifact (0-3)
    • engineered (80)
  Domains in SCOPe 2.06: d1js2c1, d1js2c2
• Chain 'D':
  Compound: high-potential iron protein
  Species: Allochromatium vinosum [TaxId:1049]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00260 (4-88)
    • cloning artifact (0-3)
    • engineered (80)
  Domains in SCOPe 2.06: d1js2d1, d1js2d2
• Heterogens: SF4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1js2A (A:)
  mefmsapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaaga
  tdewkgcqlfpgklinvngwsaswtlkag
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1js2B (B:)
  mefmsapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaaga
  tdewkgcqlfpgklinvngwsaswtlkag
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1js2C (C:)
  mefmsapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaaga
  tdewkgcqlfpgklinvngwsaswtlkag
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1js2D (D:)
  mefmsapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaaga
  tdewkgcqlfpgklinvngwsaswtlkag