PDB entry 1jrx

View 1jrx on RCSB PDB site
Description: Crystal structure of Arg402Ala mutant flavocytochrome c3 from Shewanella frigidimarina
Class: oxidoreductase
Keywords: fumarate reductase, mutant, flavocytochrome, OXIDOREDUCTASE
Deposited on 2001-08-15, released 2001-11-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavocytochrome c
    Species: Shewanella frigidimarina [TaxId:56812]
    Gene: FCC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02469 (0-End)
      • engineered (401)
    Domains in SCOPe 2.06: d1jrxa1, d1jrxa2, d1jrxa3
  • Chain 'B':
    Compound: flavocytochrome c
    Species: Shewanella frigidimarina [TaxId:56812]
    Gene: FCC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02469 (0-End)
      • engineered (401)
    Domains in SCOPe 2.06: d1jrxb1, d1jrxb2, d1jrxb3
  • Heterogens: NA, HEM, FAD, FUM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jrxA (A:)
    adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
    hfpgevactschsaheksmvycdschsfdfnmpyakkwlrdeptiaelakdkserqaala
    saphdtvdvvvvgsggagfsaaisatdsgakviliekepviggnaklaaggmnaawtdqq
    kakkitdspelmfedtmkggqnindpalvkvlsshskdsvdwmtamgadltdvgmmggas
    vnrahrptggagvgahvvqvlydnavkrnidlrmntrgievlkddkgtvkgilvkgmykg
    yywvkadavilatggfaknnervakldpslkgfistnqpgavgdgldvaenaggalkdmq
    yiqahptlsvkggvmvteavrgngailvnregkrfvneittadkasaailaqtgksayli
    fddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdf
    erpnlpralnegnyyaievtpgvhhtmggvmidtkaevmnakkqvipglygagevtggvh
    ganrlggnaisdiitfgrlageeaakyskkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrxA (A:)
    adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
    hfpgevactschsaheksmvycdschsfdfnmpyakkwlrdeptiaelakdkserqaala
    saphdtvdvvvvgsggagfsaaisatdsgakviliekepviggnaklaaggmnaawtdqq
    kakkitdspelmfedtmkggqnindpalvkvlsshskdsvdwmtamgadltdvgmmggas
    vnrahrptggagvgahvvqvlydnavkrnidlrmntrgievlkddkgtvkgilvkgmykg
    yywvkadavilatggfaknnervakldpslkgfistnqpgavgdgldvaenaggalkdmq
    yiqahptlsvkggvmvteavrgngailvnregkrfvneittadkasaailaqtgksayli
    fddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdf
    erpnlpralnegnyyaievtpgvhhtmggvmidtkaevmnakkqvipglygagevtggvh
    ganrlggnaisdiitfgrlageeaakys
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jrxB (B:)
    adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
    hfpgevactschsaheksmvycdschsfdfnmpyakkwlrdeptiaelakdkserqaala
    saphdtvdvvvvgsggagfsaaisatdsgakviliekepviggnaklaaggmnaawtdqq
    kakkitdspelmfedtmkggqnindpalvkvlsshskdsvdwmtamgadltdvgmmggas
    vnrahrptggagvgahvvqvlydnavkrnidlrmntrgievlkddkgtvkgilvkgmykg
    yywvkadavilatggfaknnervakldpslkgfistnqpgavgdgldvaenaggalkdmq
    yiqahptlsvkggvmvteavrgngailvnregkrfvneittadkasaailaqtgksayli
    fddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdf
    erpnlpralnegnyyaievtpgvhhtmggvmidtkaevmnakkqvipglygagevtggvh
    ganrlggnaisdiitfgrlageeaakyskkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrxB (B:)
    adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
    hfpgevactschsaheksmvycdschsfdfnmpyakkwlrdeptiaelakdkserqaala
    saphdtvdvvvvgsggagfsaaisatdsgakviliekepviggnaklaaggmnaawtdqq
    kakkitdspelmfedtmkggqnindpalvkvlsshskdsvdwmtamgadltdvgmmggas
    vnrahrptggagvgahvvqvlydnavkrnidlrmntrgievlkddkgtvkgilvkgmykg
    yywvkadavilatggfaknnervakldpslkgfistnqpgavgdgldvaenaggalkdmq
    yiqahptlsvkggvmvteavrgngailvnregkrfvneittadkasaailaqtgksayli
    fddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdf
    erpnlpralnegnyyaievtpgvhhtmggvmidtkaevmnakkqvipglygagevtggvh
    ganrlggnaisdiitfgrlageeaakys