PDB entry 1jrt

View 1jrt on RCSB PDB site
Description: hemiacetal complex between leupeptin and trypsin
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase, serine protease, digestion, pancreas, zymogen, hydrolase (serine protease), hydrolase-hydrolase inhibitor complex
Deposited on 1996-02-07, released 1996-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.177
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jrta_
  • Chain 'B':
    Compound: leupeptin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00487 (0-2)
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jrtA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'B':
    No sequence available.