PDB entry 1jrq

View 1jrq on RCSB PDB site
Description: X-ray Structure Analysis of the Role of the Conserved Tyrosine-369 in Active Site of E. coli Amine Oxidase
Class: oxidoreductase
Keywords: Copper amine oxidase, TPQ, mutant, OXIDOREDUCTASE
Deposited on 2001-08-14, released 2001-11-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.195
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper amine oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46883
      • engineered (368)
      • modified residue (465)
    Domains in SCOPe 2.06: d1jrqa1, d1jrqa2, d1jrqa3, d1jrqa4
  • Chain 'B':
    Compound: copper amine oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46883
      • engineered (368)
      • modified residue (465)
    Domains in SCOPe 2.06: d1jrqb1, d1jrqb2, d1jrqb3, d1jrqb4
  • Heterogens: CU, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jrqA (A:)
    hggeahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvp
    vvmkdnkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpn
    trfteisllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpi
    kdahgmvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqda
    rllkvisyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
    pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
    slggmivpfgdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
    meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
    gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
    nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
    vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
    dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
    galkkdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrqA (A:)
    mvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdn
    kawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrftei
    sllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdahgm
    vllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkvi
    syldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavkpm
    qiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslggmi
    vpfgdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvpmeipra
    iavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengtigidaga
    tgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslvam
    dpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyqii
    pyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtglgq
    yskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jrqB (B:)
    hggeahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvp
    vvmkdnkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpn
    trfteisllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpi
    kdahgmvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqda
    rllkvisyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
    pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
    slggmivpfgdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
    meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
    gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
    nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
    vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
    dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
    galkkdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrqB (B:)
    hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
    nkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrfte
    isllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdahg
    mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
    isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavkp
    mqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslggm
    ivpfgdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvpmeipr
    aiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengtigidag
    atgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslva
    mdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyqi
    ipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtglg
    qyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalkk
    d