PDB entry 1jrq

View 1jrq on RCSB PDB site
Description:
Deposited on 2001-08-14, released 2001-11-21
The last revision prior to the SCOP 1.61 freeze date was dated 2001-11-21, with a file datestamp of 2001-11-21.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.195
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jrqA (A:)
    mvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdn
    kawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrftei
    sllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdahgm
    vllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkvi
    syldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavkpm
    qiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslggmi
    vpfgdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvpmeipra
    iavferyagpeykhqemgqpnvsterrelvvrwistvgnadyifdwifhengtigidaga
    tgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslvam
    dpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyqii
    pyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtglgq
    yskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jrqB (B:)
    hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
    nkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrfte
    isllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdahg
    mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
    isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavkp
    mqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslggm
    ivpfgdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvpmeipr
    aiavferyagpeykhqemgqpnvsterrelvvrwistvgnadyifdwifhengtigidag
    atgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslva
    mdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyqi
    ipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtglg
    qyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalkk
    d