PDB entry 1jrp

View 1jrp on RCSB PDB site
Description: crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus
Deposited on 2001-08-14, released 2002-01-11
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-01, with a file datestamp of 2004-06-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.196
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jrpA (A:)
    meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
    naclmmlpqiagkalrtiegiaapdgrlhpvqqamidhhgsqcgfctpgfivsmaaahdr
    drkdyddllagnlcrctgyapilraaeaaageppadwlqadaaftlaqlssgvrgqtapa
    flpetsdaladwylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretpdg
    ygigagvtiaalrafaegphpalagllrrfaseqvrqvatiggniangspigdgppalia
    mgasltlrrgqerrrmpledffleyrkqdrrpgefvesvtlpksapglrcyklskrfdqd
    isavcgclnltlkgskietariafggmagvpkraaafeaaligqdfredtiaaalpllaq
    dftplsdmrasaayrmnaaqamalryvrelsgeavavlevmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrpA (A:)
    meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
    naclmmlpqiagkalrtiegiaapdgrlhpvqqamidhhgsqcgfctpgfivsmaaahdr
    drkdyddllagnlcrctgyapilraaeaaageppadwlqadaaftlpaflpetsdaladw
    ylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretpdgygigagvtiaal
    rafaegphpalagllrrfaseqvrqvatiggniangspigdgppaliamgasltlrrgqe
    rrrmpledffleyrkqdrrpgefvesvtlpksapglrcyklskrfdqdisavcgclnltl
    kgskietariafggmagvpkraaafeaaligqdfredtiaaalpllaqdftplsdmrasa
    ayrmnaaqamalryvrelsgeavavlevmp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jrpB (B:)
    msvgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespg
    viavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkarity
    aprpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqa
    alalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlai
    acavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgws
    adlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehl
    argmgrdpaelralnfydppergglsappsppepiatkktqtthygqevadcvlgelvtr
    lqksanfttrraeiaawnstnrtlargialspvkfgisftlthlnqagalvqiytdgsva
    lnhggtemgqglhakmvqvaaavlgidpvqvritatdtskvpntsataassgadmngmav
    kdacetlrgrlagfvaaregcaardvifdagqvqasgkswrfaeivaaaymarislsatg
    fyatpklswdrlrgqgrpflyfaygaaitevvidrltgenrilrtdilhdagaslnpald
    igqiegayvqgagwltteelvwdhcgrlmthapstykipafsdrprifnvalwdqpnree
    tifrskavgeppfllgisaflalhdacaacgphwpdlqapatpeavlaavrraegra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrpB (B:)
    svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
    iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
    prpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaa
    lalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaia
    cavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsa
    dlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehla
    rgmgrdpaelralnfydppekktqtthygqevadcvlgelvtrlqksanfttrraeiaaw
    nstnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnhggtemgqglhakmv
    qvaaavlgidpvqvritatdtskvpntsataassgadmngmavkdacetlrgrlagfvaa
    regcaardvifdagqvqasgkswrfaeivaaaymarislsatgfyatpklswdrlrgqgr
    pflyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigqiegayvqgagwltt
    eelvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetifrskavgeppfllgi
    saflalhdacaacgphwpdlqapatpeavlaavrraegra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jrpC (C:)
    meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
    naclmmlpqiagkalrtiegiaapdgrlhpvqqamidhhgsqcgfctpgfivsmaaahdr
    drkdyddllagnlcrctgyapilraaeaaageppadwlqadaaftlaqlssgvrgqtapa
    flpetsdaladwylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretpdg
    ygigagvtiaalrafaegphpalagllrrfaseqvrqvatiggniangspigdgppalia
    mgasltlrrgqerrrmpledffleyrkqdrrpgefvesvtlpksapglrcyklskrfdqd
    isavcgclnltlkgskietariafggmagvpkraaafeaaligqdfredtiaaalpllaq
    dftplsdmrasaayrmnaaqamalryvrelsgeavavlevmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrpC (C:)
    meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
    naclmmlpqiagkalrtiegiaapdgrlhpvqqamidhhgsqcgfctpgfivsmaaahdr
    drkdyddllagnlcrctgyapilraaeaaageppadwlqadaaftlpaflpetsdaladw
    ylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretpdgygigagvtiaal
    rafaegphpalagllrrfaseqvrqvatiggniangspigdgppaliamgasltlrrgqe
    rrrmpledffleyrkqdrrpgefvesvtlpksapglrcyklskrfdqdisavcgclnltl
    kgskietariafggmagvpkraaafeaaligqdfredtiaaalpllaqdftplsdmrasa
    ayrmnaaqamalryvrelsgeavavlevmp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jrpD (D:)
    msvgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespg
    viavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkarity
    aprpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqa
    alalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlai
    acavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgws
    adlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehl
    argmgrdpaelralnfydppergglsappsppepiatkktqtthygqevadcvlgelvtr
    lqksanfttrraeiaawnstnrtlargialspvkfgisftlthlnqagalvqiytdgsva
    lnhggtemgqglhakmvqvaaavlgidpvqvritatdtskvpntsataassgadmngmav
    kdacetlrgrlagfvaaregcaardvifdagqvqasgkswrfaeivaaaymarislsatg
    fyatpklswdrlrgqgrpflyfaygaaitevvidrltgenrilrtdilhdagaslnpald
    igqiegayvqgagwltteelvwdhcgrlmthapstykipafsdrprifnvalwdqpnree
    tifrskavgeppfllgisaflalhdacaacgphwpdlqapatpeavlaavrraegra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrpD (D:)
    svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
    iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
    prpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaa
    lalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaia
    cavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsa
    dlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehla
    rgmgrdpaelralnfydppekktqtthygqevadcvlgelvtrlqksanfttrraeiaaw
    nstnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnhggtemgqglhakmv
    qvaaavlgidpvqvritatdtskvpntsataassgadmngmavkdacetlrgrlagfvaa
    regcaardvifdagqvqasgkswrfaeivaaaymarislsatgfyatpklswdrlrgqgr
    pflyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigqiegayvqgagwltt
    eelvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetifrskavgeppfllgi
    saflalhdacaacgphwpdlqapatpeavlaavrraegra
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1jrpE (E:)
    meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
    naclmmlpqiagkalrtiegiaapdgrlhpvqqamidhhgsqcgfctpgfivsmaaahdr
    drkdyddllagnlcrctgyapilraaeaaageppadwlqadaaftlaqlssgvrgqtapa
    flpetsdaladwylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretpdg
    ygigagvtiaalrafaegphpalagllrrfaseqvrqvatiggniangspigdgppalia
    mgasltlrrgqerrrmpledffleyrkqdrrpgefvesvtlpksapglrcyklskrfdqd
    isavcgclnltlkgskietariafggmagvpkraaafeaaligqdfredtiaaalpllaq
    dftplsdmrasaayrmnaaqamalryvrelsgeavavlevmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrpE (E:)
    meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
    naclmmlpqiagkalrtiegiaapdgrlhpvqqamidhhgsqcgfctpgfivsmaaahdr
    drkdyddllagnlcrctgyapilraaeaaageppadwlqadaaftlpaflpetsdaladw
    ylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretpdgygigagvtiaal
    rafaegphpalagllrrfaseqvrqvatiggniangspigdgppaliamgasltlrrgqe
    rrrmpledffleyrkqdrrpgefvesvtlpksapglrcyklskrfdqdisavcgclnltl
    kgskietariafggmagvpkraaafeaaligqdfredtiaaalpllaqdftplsdmrasa
    ayrmnaaqamalryvrelsgeavavlevmp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1jrpF (F:)
    msvgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespg
    viavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkarity
    aprpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqa
    alalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlai
    acavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgws
    adlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehl
    argmgrdpaelralnfydppergglsappsppepiatkktqtthygqevadcvlgelvtr
    lqksanfttrraeiaawnstnrtlargialspvkfgisftlthlnqagalvqiytdgsva
    lnhggtemgqglhakmvqvaaavlgidpvqvritatdtskvpntsataassgadmngmav
    kdacetlrgrlagfvaaregcaardvifdagqvqasgkswrfaeivaaaymarislsatg
    fyatpklswdrlrgqgrpflyfaygaaitevvidrltgenrilrtdilhdagaslnpald
    igqiegayvqgagwltteelvwdhcgrlmthapstykipafsdrprifnvalwdqpnree
    tifrskavgeppfllgisaflalhdacaacgphwpdlqapatpeavlaavrraegra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrpF (F:)
    svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
    iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
    prpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaa
    lalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaia
    cavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsa
    dlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehla
    rgmgrdpaelralnfydppekktqtthygqevadcvlgelvtrlqksanfttrraeiaaw
    nstnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnhggtemgqglhakmv
    qvaaavlgidpvqvritatdtskvpntsataassgadmngmavkdacetlrgrlagfvaa
    regcaardvifdagqvqasgkswrfaeivaaaymarislsatgfyatpklswdrlrgqgr
    pflyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigqiegayvqgagwltt
    eelvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetifrskavgeppfllgi
    saflalhdacaacgphwpdlqapatpeavlaavrraegra
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1jrpG (G:)
    meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
    naclmmlpqiagkalrtiegiaapdgrlhpvqqamidhhgsqcgfctpgfivsmaaahdr
    drkdyddllagnlcrctgyapilraaeaaageppadwlqadaaftlaqlssgvrgqtapa
    flpetsdaladwylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretpdg
    ygigagvtiaalrafaegphpalagllrrfaseqvrqvatiggniangspigdgppalia
    mgasltlrrgqerrrmpledffleyrkqdrrpgefvesvtlpksapglrcyklskrfdqd
    isavcgclnltlkgskietariafggmagvpkraaafeaaligqdfredtiaaalpllaq
    dftplsdmrasaayrmnaaqamalryvrelsgeavavlevmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrpG (G:)
    meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
    naclmmlpqiagkalrtiegiaapdgrlhpvqqamidhhgsqcgfctpgfivsmaaahdr
    drkdyddllagnlcrctgyapilraaeaaageppadwlqadaaftlpaflpetsdaladw
    ylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretpdgygigagvtiaal
    rafaegphpalagllrrfaseqvrqvatiggniangspigdgppaliamgasltlrrgqe
    rrrmpledffleyrkqdrrpgefvesvtlpksapglrcyklskrfdqdisavcgclnltl
    kgskietariafggmagvpkraaafeaaligqdfredtiaaalpllaqdftplsdmrasa
    ayrmnaaqamalryvrelsgeavavlevmp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jrpH (H:)
    msvgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespg
    viavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkarity
    aprpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqa
    alalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlai
    acavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgws
    adlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehl
    argmgrdpaelralnfydppergglsappsppepiatkktqtthygqevadcvlgelvtr
    lqksanfttrraeiaawnstnrtlargialspvkfgisftlthlnqagalvqiytdgsva
    lnhggtemgqglhakmvqvaaavlgidpvqvritatdtskvpntsataassgadmngmav
    kdacetlrgrlagfvaaregcaardvifdagqvqasgkswrfaeivaaaymarislsatg
    fyatpklswdrlrgqgrpflyfaygaaitevvidrltgenrilrtdilhdagaslnpald
    igqiegayvqgagwltteelvwdhcgrlmthapstykipafsdrprifnvalwdqpnree
    tifrskavgeppfllgisaflalhdacaacgphwpdlqapatpeavlaavrraegra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrpH (H:)
    svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
    iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
    prpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaa
    lalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaia
    cavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsa
    dlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehla
    rgmgrdpaelralnfydppekktqtthygqevadcvlgelvtrlqksanfttrraeiaaw
    nstnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnhggtemgqglhakmv
    qvaaavlgidpvqvritatdtskvpntsataassgadmngmavkdacetlrgrlagfvaa
    regcaardvifdagqvqasgkswrfaeivaaaymarislsatgfyatpklswdrlrgqgr
    pflyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigqiegayvqgagwltt
    eelvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetifrskavgeppfllgi
    saflalhdacaacgphwpdlqapatpeavlaavrraegra