PDB entry 1jrm

View 1jrm on RCSB PDB site
Description: NMR structure of MTH0637. Ontario Centre for Structural Proteomics target MTH0637_1_104; Northeast Structural Genomics Target TT135
Class: structural genomics, unknown function
Keywords: alpha-beta protein, STRUCTURAL GENOMICS, OCSP, NESG, PROTEIN STRUCTURE INITIATIVE, PSI, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2001-08-14, released 2002-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CONSERVED HYPOTHETICAL PROTEIN mth637
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26734 (0-103)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1jrma1, d1jrma2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jrmA (A:)
    vitmdclrevgddllvnievspasgkfgipsynewrkrievkihsppqkgkanreiikef
    setfgrdveivsgqksrqktiriqgmgrdlflklvsekfgleip